SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316056.RPC_0697 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316056.RPC_0697
Domain Number 1 Region: 7-178
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.35e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316056.RPC_0697
Sequence length 186
Comment (Rhodopseudomonas palustris BisB18)
Sequence
MMPDSRIELRFGGTGGQGLILSGKMLADALAQEGKHVAQSQTYEPTSRGGFCNADLVVAN
GEVDYPLPIAFDYLVLLDKLAIKPSWPRLKPDALVIADTRLCPELPDGKYPRHHLPLSRT
ALELGNERVTNIVALGALIALSGICKRQSIERVVRAGSPRAFLDLNLDALAAGYALATTP
VAAAAS
Download sequence
Identical sequences Q21BG7
316056.RPC_0697 gi|90422218|ref|YP_530588.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]