SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316056.RPC_1452 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316056.RPC_1452
Domain Number 1 Region: 10-93
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000334
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316056.RPC_1452
Sequence length 377
Comment (Rhodopseudomonas palustris BisB18)
Sequence
MDGNPTLEQIARGNGLALCAAGSWTAPFAPVLERIVAEAEALSGTRPNISIDVSAVAKLD
TFGAWLIERLRRSLTQGDAEATIAGLSANYSSLVDEVRRVKDPEPSKRGGISLRAPVERL
GRSVAGFLDTIVGLVAMTGAVMAGMLRVVMHPGSFRLTSTVHHLEQVCWRAVPIVMLITF
LIGCIVAQQGIFHFRKFGADVFVVDMLGVLVLRELGVLLVAIMVAGRSGSAYTAELGSMK
MREEIDALRTMGFDPIDVLIMPRMMALVLAMPILTFLGVVAALYGGGLVAWLYGGVDPDA
FLLRLRDAISIDHFTVGMIKAPVMAIVIGIVACVEGLAVAGSAESLGRHTTASVVKGIFF
VIVMDGVFAIFFASIGM
Download sequence
Identical sequences Q219C2
316056.RPC_1452 WP_011471919.1.69038 gi|90422963|ref|YP_531333.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]