SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316056.RPC_4678 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316056.RPC_4678
Domain Number 1 Region: 12-90
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316056.RPC_4678
Sequence length 105
Comment (Rhodopseudomonas palustris BisB18)
Sequence
MEIKSPQPSLRLPADCSIAGIRAVYDLIRSLLSQQRDLQVDCSAVDKADVTSVQLLLSAT
RTADEQGGRLDLTDLSQNLRTTFQRAGVSSSAFSERTDAEQSETK
Download sequence
Identical sequences Q20XD6
316056.RPC_4678 2005229402 gi|90426149|ref|YP_534519.1| WP_011475077.1.69038 2005391534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]