SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316057.RPD_0959 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316057.RPD_0959
Domain Number 1 Region: 1139-1484
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.68e-42
Family PFOR PP module 0.00053
Further Details:      
 
Domain Number 2 Region: 17-229
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2e-42
Family PFOR Pyr module 0.00028
Further Details:      
 
Domain Number 3 Region: 549-766
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.66e-42
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00078
Further Details:      
 
Domain Number 4 Region: 361-500
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.14e-24
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0035
Further Details:      
 
Domain Number 5 Region: 841-877,953-1001
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000011
Family Ferredoxin domains from multidomain proteins 0.046
Further Details:      
 
Weak hits

Sequence:  316057.RPD_0959
Domain Number - Region: 1601-1625
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0542
Family Single 4Fe-4S cluster ferredoxin 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316057.RPD_0959
Sequence length 1669
Comment (Rhodopseudomonas palustris BisB5)
Sequence
MEMERPMNAKYPGIPSVIHGNGAVAQVMGHVCGGVIGYPITPSTEISEIYEAFRSSGGCN
VWGKHPFFFEPEGEHSAQSGALGAALTGGKFISNASSSQGILYGLESHYVTVGKKVGGFV
LQVAARVVSKHSLNVMAGHDDVYALLSSGYTILFGSNPQEAADLAAISYKVAATSLIPVA
NAMDGFATSHMLSEALMPEPELLRDFLGDPAGRIKCPTVAQEMLFGAKGRVFQLKQYLAR
HDADFVPADLAALKAHLDANADAIETDGDARLIDATLQFVPEELRAQWKRQWINAPEKGT
RQLVPALVDIDNPGLTGGVQNQPDFQAGAVDHRTHFVNAVPRFVREAMDEYASLTGREYK
PVMTYMCDDAETVMVGLGSVTDDAEAVAAYLRSQGKKVGVISVKMLQPFPEAELVAALKG
KKAVTILERSDVTALTSLVTQALCKARENGDAGVRHAGIPALDKLPKITTAIFGLGGHDL
QPRDLIACYANMEKPDSAPFVYLGTRFFTENASPRMAALQNRLKAAYPETEFMALQTGTN
PNLLPPSAFRIRFHSIGGYGTIASGKLLTDILAGALDMHSKSAPKYGSEKSGAPTNYYIT
LSPEPVKITNAELEDVEIVISPDHKVFVHTNPLRGLIEGGTFILQTNLSPLEVWRDLPAK
ARATIRDKKIKFYLIDAFAVAKRHAPTAELETRMMGIAFIGAVCGNVDRVVADASQDAML
NKIRQQIAKKFGAKGGDIVEGNMAVIREGLEATNKIDYDAPEFSEDAIKAAPKKKADASI
SASMCRAASPASASGFLDPQYYDDVLAGPFRDGTIADAPVLPGIGMFMPAGSAAAKDKGL
FRRNVPEFKADLCTGCMECALVCPDAAIPNAVHDIHELLGTAIQQLDIAPAQQEALRGQV
PSLSEAIREVYRSGKDDKPFHEVVTQAADALDVGNATLKRNFGKLSAALSVYPVSRTRPF
FDAMEKSQPGTGGLYSVSVDPWKCSGCLECIDVCGPGALVDREQDEPLLEQLQARFEFLS
RTPNTPARFTESATKPDGETKRLMLDRANYYATTGGHGACRGCGEVTAIRLVTSTNHAIH
DKRRKEHTRELEGLIDQLTAKRAQVASDPARAARIDATLKTLEKRLYLYESGPTGNGPSG
MVIANATGCSSVYASTFPFNPYTDPWVNSLFQDTPAVAKGIFEGLTAQASDDFRALRVAR
LELADAYDPAKHDGYFRYFGWGQFTPDERSLLPTVLSMGGDGATYDIGFGALSRLLSTKT
PIKVVVLNTGAYSNTGGQTSTASLTGQDSDLSRFGIANHGKQESRKELGLIASFHPNVFV
VQTATALQGHFLKNVMEFLNHTSSPAVLDVYTPCQAEHGIGDAVANRQARKAVESRMNPV
FVHDPRKGNKLDNWFSLDGNPEPDQDWASQSIEYVDDNGATQLLKAKVTPADFAYSEVRF
RKQFKPLKKDADGLPVDEYVALDADARTGKTPFIYGTDGDKKLVKLAVGESVIALVEERR
KYWRTLQYLGGFDVRALDESHRVELEALQHQYEESVKSRETSLDAIARGMSELAASSNAP
AANGFAGLMAGLAPSPAAAAQTNGSKPANGANGGAHIDIAETDLDKCTNCKSCYQDVPEV
FELTKIVVGGASKDVAHVIPGVFGKLKVTPELSAKLNRAAANCDAEIIR
Download sequence
Identical sequences Q13CJ2
316057.RPD_0959 gi|91975439|ref|YP_568098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]