SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316057.RPD_1636 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316057.RPD_1636
Domain Number 1 Region: 19-101
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000922
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 316057.RPD_1636
Sequence length 383
Comment (Rhodopseudomonas palustris BisB5)
Sequence
MAQQLALDGGPTLEHIARGEGLALCAAGSWTARFAPSLERIVADAEKLTGTRPNIFIDVS
EVARLDTFGAWLIERLRRNLTQDGVEARIAGLSANYASLVDEVRQVQPDVPAVASGGALR
APIEKLGRTMYVFADDIVALISMLGAVLAGVMRAILHPTTFRLTSTVHHLEQVCWRAVPI
VVLITFLIGCIIAQQGIFHFRRFGADVFVVDMLGVLVLREIGVLLVAIMVAGRSGSAYTA
ELGSMKMREEIDALRTMGFDPIDVLIVPRLIALLLAMPILTFLGAMSALYGGGLVAWLYG
GVDPEAFLLRLRDAISINHFTVGMIKAPVMALVIGIVACVEGLAVKGSAESLGSHTTASV
VKGIFFVIVMDGVFAIFFASIGI
Download sequence
Identical sequences A0A1H8USI5 Q13AL6
WP_011502057.1.14473 WP_011502057.1.68018 316057.RPD_1636 gi|91976115|ref|YP_568774.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]