SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316057.RPD_4009 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316057.RPD_4009
Domain Number 1 Region: 6-177
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.31e-29
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316057.RPD_4009
Sequence length 185
Comment (Rhodopseudomonas palustris BisB5)
Sequence
MPKSRIELRFGGTGGQGLLLSAKLLADALALEGRHVAQSQTYEPTSRGGFCNADLVVASG
EVDYPLPMEFDHLVLLDKIAIKPSWPRLKAGALVIADTRLCPELPEGAGQRHQLPLSRTA
IELGSERVTNIVALAVLVAMTDICKRKSVEQVIRSSSPRGFLDLNMDALAAGYALASAPA
VLAAS
Download sequence
Identical sequences Q131L1
316057.RPD_4009 WP_011504389.1.68018 gi|91978470|ref|YP_571129.1| 2005392658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]