SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316057.RPD_4242 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316057.RPD_4242
Domain Number 1 Region: 285-432
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-21
Family Histidine kinase 0.0049
Further Details:      
 
Domain Number 2 Region: 213-294
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000157
Family Homodimeric domain of signal transducing histidine kinase 0.0034
Further Details:      
 
Weak hits

Sequence:  316057.RPD_4242
Domain Number - Region: 117-145
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0497
Family NfeD domain-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316057.RPD_4242
Sequence length 463
Comment (Rhodopseudomonas palustris BisB5)
Sequence
MIGSLRVRLFFVLLGATGIVWIAAVIWIYASSQRELENVLDTRLQEAARMVVSLVGSIEG
HVPETLPELSSAPAVTGNYERQLSCQVWSIQGRMIGRSSGAPEQRLSDQNAGFSERQIDG
ETWRVYATEDAAKGFRVLVGDRLGLRERLVADLIKGLLWPALLIAPLLGLLIWISVGRGL
RPLQAIASDLVGRDADDMRPVDASRTPSEVMPLATALNALFDKVALARRHEREITAFAAH
ELRSPLTGLKTQAQVALATTDPAVARAALQQILVAVDRATRLVRQLLTLARLDARAETDD
HGRLPMRAVINDVVRMTPRPDGVAVVIDDDLTGVTWTGNRECLELAIRNLHENAIQHMQG
AGEVRWRAGASPRSIVIEDTGPGVPEDELPKIGQRFFRGRNKSAIGSGLGLAITSLALDR
TGADLQIGNRHDRRGFQAEIKLRALDSGAEVARGKAQKLTEPV
Download sequence
Identical sequences Q130N0
gi|91978701|ref|YP_571360.1| 316057.RPD_4242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]