SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316058.RPB_1233 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316058.RPB_1233
Domain Number 1 Region: 26-253
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.92e-45
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.01
Further Details:      
 
Domain Number 2 Region: 247-306
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000000377
Family 7-Fe ferredoxin 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316058.RPB_1233
Sequence length 315
Comment (Rhodopseudomonas palustris HaA2)
Sequence
MNEQSKVAALNADSEPVAFNAALAEPFNVLIVGVGGQGVIMVSKVLAALAQAHGFEVKQS
EVHGMAKRGGAVFSHVRFGQRVWSPTIPKGEADVLIALEWAEGLRWLPHLKRETGVFICD
TKRIVPPFACLNRRLGAPLRYSTETAEQVSAYVSEAYAIDATRMAEELGNDRAANVVLLG
ALSTVLEFALPEWEKTVTSFVPKKTIAVNSAAFELGRNWIAEAKTAPPADDAAARPAPVH
AHYAARLEITDAWCKSCEICVKLCPERCLTLNADRIVEMTAPEKCTGCRLCEWLCPDFAI
RVHLDTDAAVMEAAR
Download sequence
Identical sequences Q2J0R7
WP_011440132.1.50975 316058.RPB_1233 gi|86748358|ref|YP_484854.1| 2005292708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]