SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316058.RPB_2349 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316058.RPB_2349
Domain Number 1 Region: 718-924
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 4.84e-29
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0059
Further Details:      
 
Domain Number 2 Region: 46-206
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000171
Family Pyruvate oxidase and decarboxylase Pyr module 0.047
Further Details:      
 
Domain Number 3 Region: 436-620
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.00000000000000442
Family Pyruvate oxidase and decarboxylase PP module 0.08
Further Details:      
 
Domain Number 4 Region: 271-392
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.0000178
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316058.RPB_2349
Sequence length 1161
Comment (Rhodopseudomonas palustris HaA2)
Sequence
MGIDQGPISLDQKYTQHSGHIFLTGIQALVRLPMAQVRRDRAAGLKTAGFVTGYRGSPLG
GYDQQLVAARRHLEQYNVKFQPGVNEDLAATAIWGTQQLNLSPGAQYDGVTGIWYGKGPG
VDRCGDVFRHGNAAGSAKNGGVLCLAGDDHGAKSSTVPHQSDHAFIAALMPYLYPSSIHE
IIEMGLLGIAMSRYSGCWVGMKVITETVETTAEINLADEMTPFVIPTDFEMPPGGLNLRW
PDDRYDQDRRLQDYKGFAAIAFARANKVNRITMDSPNARFGIMASGKSYEDVRQALRELG
IDEQVAARIGLRLYKIGMPWPLEPEGVRAFAHGLEEIFVVEERREIVENQLKQQLFSTRD
RPRVIGKMDEHEHRFLPFAQELSVAKVATSLVDRLLAMEIDPTIAEMLRAKADWFHGRDA
SQVQNVVPIARTPYFCSGCPHNTSTKVPEGSRALAGIGCHFMSLWMDRNTETFTHMGGEG
VPWVGIAPFTEEKHIFANLGDGTYFHSGSLAIRQSIASKANITYKILYNDAVAMTGGQRH
DGDLSPQQITYQLHAEGIRAIYLVSETPDAYPADSIAPGTHLRHRDELDAVMKECREIEG
ASAIVFVQTCAAEKRRRRKRGTLEDPPRRVMINAAVCEGCGDCSVQSNCISVEPLETELG
RKRKINQSTCNKDYSCLKGFCPSFVTIDGGALRKRAPVDLGDLGALPEPAARPGLDKPYN
IAVGGVGGTGVLTIGALLGMAAHIEGKASMILDMSGLAQKGGAVLSHVRLSDKPEDVTCS
RIVTGTADVLIVADEVMAISKETISLCEPSRTHGIVNTHLIPIADFIRNRDFDFQTRKVN
SVLEGALRRDSAFLDFTKAAETLLGDSIATNMMMMGYAYQQGLLPLQAASIQQAIELNGV
SIKMNTQAFNLGRLAAADPVRLASLLQGAGQTVAAKTQGEMSLDEIIAHRSAMLTDYQSR
RLAKRYGDLVETVRRAADAGGYGDELPRAVAINYAKLLAYKDEYEVARLLTEPAFEQQIR
DQFEGDYKISFNLAPPILPGVDVTGRPKKRQFGEGMRPVFRTLAKLRALRGTPLDVFGYH
PERKLERKLIADYEADVASVLQSLSPATIDTAVELLSLPDLIRGYGPIKQKSVDDTAPRY
AELRANLRDPQPAPPRQMAAE
Download sequence
Identical sequences Q2IXK6
316058.RPB_2349 2005291114 gi|86749469|ref|YP_485965.1| WP_011441239.1.50975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]