SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316058.RPB_4061 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316058.RPB_4061
Domain Number 1 Region: 125-372
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.18e-57
Family D-glucarate dehydratase-like 0.0008
Further Details:      
 
Domain Number 2 Region: 7-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.99e-30
Family Enolase N-terminal domain-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316058.RPB_4061
Sequence length 375
Comment (Rhodopseudomonas palustris HaA2)
Sequence
MTAQDFTIRSIEAMCFRYPLSLPVVTSFGRMTTRPAVFIRVTDEDGISGWGEAWANFPAT
GAEHRARTINEVLAPLAAGARIAHPSEFFEALTQRTAVLALQSGEQGPFAQAIAGIDLAL
WDLFARRRATPLWRLLGGANATIKVYASGINPTGTREMAETALARGHRALKLKIGFGAEI
DHPNLAALRALAGDGTLAADANQAWTLQQACEAAPHLRDYNLAWLEEPIRADRPWPEWQA
LRRAATMPLAAGENFASRESFQQALSDDTLGVIQPDIAKWGGLSACAPIARDIVAAGKRF
CPHYLGGGIGLLASAHLLAGIGGDGLLEVDANDNPLREAFCGPVAAISDGAITLGDAPGL
GVEPDLVGIAQYRTV
Download sequence
Identical sequences Q2ISQ6
316058.RPB_4061 2005296013 WP_011442938.1.50975 gi|86751169|ref|YP_487665.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]