SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316058.RPB_4540 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  316058.RPB_4540
Domain Number - Region: 96-151
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00981
Family NfeD domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316058.RPB_4540
Sequence length 153
Comment (Rhodopseudomonas palustris HaA2)
Sequence
MAELFVALGSWNWLIVGFVLMALELLAPGIFLFWLGVAALLTGVATFALASVLALSWQAQ
ALLFAALAVAAVPLWRRMARGGAAESSTTNPFLNRRSDALVGRVFTLEKPIEGGVGTVRI
DDTFWRVTGPDAPAGSRVKIVHADGVNLTVAGV
Download sequence
Identical sequences Q2IRD7
316058.RPB_4540 WP_011443406.1.50975 2005294420 gi|86751638|ref|YP_488134.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]