SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316067.Geob_0375 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316067.Geob_0375
Domain Number 1 Region: 803-1189
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.44e-129
Family PFOR PP module 0.0000000164
Further Details:      
 
Domain Number 2 Region: 423-675
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.83e-82
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000427
Further Details:      
 
Domain Number 3 Region: 4-258
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.83e-75
Family PFOR Pyr module 0.0000000381
Further Details:      
 
Domain Number 4 Region: 259-418
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.28e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000634
Further Details:      
 
Domain Number 5 Region: 672-844
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 8.09e-21
Family Ferredoxin domains from multidomain proteins 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316067.Geob_0375
Sequence length 1193
Comment (Geobacter FRC 32)
Sequence
MSRRMVTIDGNTAAAHVAHATNEVIAIYPITPSSVMGEISDEKSANGEKNIWDTVPLVTE
MQSEGGASGAVHGALQAGALTTTFTASQGLLLMIPNMFKIAGELTSTVFHVSARAIAAQA
LSIFGDHSDVMACRSTGWAMLCSNNVQEVMDFALIAQAATLRARVPFVHFFDGFRTSHEV
QKVEELTFDDMRAMINDDLVLAHRARALSPDHPVMRGSAQNPDVYFQGRESVNQYYGPTI
GIVQEEMDKFAKLVGRQYKLVEYVGAADAERVIIVMGSAADTIHETVETLVAKGEKVGLL
KIRLFRPFPTDAFVAAIPASVKKIAVLDRTKEPGSLGEPLYLDIRTAIGEAMADKKTSFT
QYPVIVGGRYGLGSKEFTPAMAKSVFDNLKEDKPKSNFVTGIKEDVCNTSLAFDPSFANA
AAGTYSAMFYGLGSDGTVGANKNSIKIIGEKTDNNVQAYFVYDSKKAGSVTTSHLRFGKN
IIRSPYLIDRADFIACHNFTFLEKYDMLSKAKEGSTFLLCSPFDKDQVWDKMPVEVQQQI
IDKKLKFYVINAIKLGEELGLGARINVIMQTAFFKISSIIPLEIALDAIKDAIKKSYGKA
GEKVVDMNNKAVDAALENVFQVTVPATASSQLKKPPVVGSHAPAFVQDVTAEIIAGRGDD
LPVSAMPSDGTFPTATSQYEKRNIAVDIPVWDESLCIQCGICSFVCPHATIRMKAYDPSL
LGKAPKTFKSVDAKGAEFAGKKFTLQVAPEDCTGCAACVHNCPAKSKEKPNHKAINMQFQ
PPLREAEAENYDFFLSLPETEAKLVKRETLKGSQLIRPLFEYSGACAGCGETPYLKLMSQ
LFGDRALIANATGCTSIYGGNLPTTPWAKRADGRGPAWSNSLFEDNAEFGFGMRLTVDKF
TEAATELLDELMNCGCKSCASLIGTMKEIRNADQSTQEGIEAQRERVATLKKGLETCTEP
AAKRLISLADYLVKKSVWIVGGDGWAYDIGYGGLDHVIASGKNVNLLVLDTEVYSNTGGQ
ASKSTPLGAVAQFAAGGKAMPKKDLAMIAMAYGNVYVAKVALSNPAQVVKAFIEAEAYDG
PSLIIAYAHCIAHGIDMTTAVDEQKNAVASGHWPLIRYNPELAAEGKNPLQLDSKAPTIS
FEQYAYGENRYRVLKKSNPEAAAALMKQATQWTSRRFELYEKMAAMSYDADKK
Download sequence
Identical sequences B9LZ12
316067.Geob_0375 gi|222053483|ref|YP_002535845.1| WP_012645473.1.88144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]