SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316067.Geob_2795 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316067.Geob_2795
Domain Number 1 Region: 5-193
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 3.14e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316067.Geob_2795
Sequence length 193
Comment (Geobacter FRC 32)
Sequence
MSGKITNILMVGVGGQGTLLASEILSEVLKEAGFDVKKSEIHGMSQRGGSVVSHVRFGNE
VNSPIIPEGEADILLGFELLESYRYLPLLKKGCKLVVNDLKINPSIVSTGGEAYPEGLEE
KIRQRFPDCILLDGLKLATSAGNAKTANTVLIGALSKRLDIDEKYWLAAIGKMVPPKAVE
INRKAFYLGREAA
Download sequence
Identical sequences B9M226
gi|222055883|ref|YP_002538245.1| WP_012647872.1.88144 316067.Geob_2795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]