SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316067.Geob_3040 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316067.Geob_3040
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.06e-27
Family Anti-sigma factor antagonist SpoIIaa 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 316067.Geob_3040
Sequence length 111
Comment (Geobacter FRC 32)
Sequence
MNLRTELKNDIVIIYVNEERLDAHNSGELKVEVQKLFEQGRKNMLIDLKDVRFIDSSGLG
ALVSGFKNAISHQGNLKLSTLQSQVKSMFELTRLHRVFEIFPSTAEALENF
Download sequence
Identical sequences B9M3G2
gi|222056122|ref|YP_002538484.1| WP_012648111.1.88144 316067.Geob_3040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]