SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316067.Geob_3693 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316067.Geob_3693
Domain Number 1 Region: 10-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000491
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 316067.Geob_3693
Sequence length 114
Comment (Geobacter FRC 32)
Sequence
MTVSLQKPLTLSLHGDWSVAGIAGQWALVSAYLAGLKNDNEGADEASRRILISMEGIDAL
DACGCQLMAIFVRDVRKIGIEPCLTAVPDNLHGIISALGFTHHFQNMDPGAIEQ
Download sequence
Identical sequences B9M711
gi|222056771|ref|YP_002539133.1| WP_012648758.1.88144 316067.Geob_3693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]