SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316273.XCV0604 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316273.XCV0604
Domain Number 1 Region: 13-110
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.49e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 316273.XCV0604
Sequence length 139
Comment (Xanthomonas campestris vesicatoria 85-10)
Sequence
MTTLAIQIDPPQDTRQRVILTGRLDTHTYQDLDAALSPLLGTRITTLVLDLSALEYISSA
GIRCIFKARKALATRQGKVLVSNPQPQIRKVFDMVKAVPLSDVFASTEELDAYLAAMQRK
VIEQSAQSDTPIVPHFAEA
Download sequence
Identical sequences A0A099Q503 G2LQX3 Q3BY28
gi|78046160|ref|YP_362335.1| 316273.XCV0604 WP_011346238.1.100156 WP_011346238.1.10442 WP_011346238.1.11230 WP_011346238.1.13735 WP_011346238.1.15826 WP_011346238.1.199 WP_011346238.1.21303 WP_011346238.1.21317 WP_011346238.1.2230 WP_011346238.1.2259 WP_011346238.1.23534 WP_011346238.1.25114 WP_011346238.1.27112 WP_011346238.1.29361 WP_011346238.1.3003 WP_011346238.1.331 WP_011346238.1.37942 WP_011346238.1.39371 WP_011346238.1.40690 WP_011346238.1.43396 WP_011346238.1.44794 WP_011346238.1.46449 WP_011346238.1.46677 WP_011346238.1.48351 WP_011346238.1.49886 WP_011346238.1.51091 WP_011346238.1.55770 WP_011346238.1.60785 WP_011346238.1.64411 WP_011346238.1.66420 WP_011346238.1.67180 WP_011346238.1.67877 WP_011346238.1.75734 WP_011346238.1.772 WP_011346238.1.77810 WP_011346238.1.79359 WP_011346238.1.81489 WP_011346238.1.8544 WP_011346238.1.89212 WP_011346238.1.89360 WP_011346238.1.94946 WP_011346238.1.99285 gi|346723496|ref|YP_004850165.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]