SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316273.XCV1304 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  316273.XCV1304
Domain Number - Region: 57-150
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00447
Family Quinoprotein alcohol dehydrogenase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316273.XCV1304
Sequence length 195
Comment (Xanthomonas campestris vesicatoria 85-10)
Sequence
MTSGNHRTKSFALPFLFLVFALAACQQAASTTTSMPSSQEPSIKAVPAPVATPAASASGT
ENWQLSVSPGEDGTYRIHVADADGKELQVIDGQEGKPPYEAADLLKLDDFTGDGKPDILA
RGLSAGASALTSESIYVYDAESGRFLDAELFENDGEVTKTGPGCIEVEHRNPDNMTYSKD
QYCWQGKWVFKGSKD
Download sequence
Identical sequences A0A249RGK1 A0A2D2QS17 Q3BW28
316273.XCV1304 WP_011346762.1.100156 WP_011346762.1.25999 WP_011346762.1.31364 WP_011346762.1.34103 WP_011346762.1.46677 WP_011346762.1.64541 WP_011346762.1.76535 WP_011346762.1.85778 WP_011346762.1.89212 gi|78046860|ref|YP_363035.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]