SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316273.XCV1320 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316273.XCV1320
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.67e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316273.XCV1320
Sequence length 120
Comment (Xanthomonas campestris vesicatoria 85-10)
Sequence
MERIPILRMGHLLLVTIQVDMHDQLALQLQDDLSEKISATSARGVLIDISALDIVDSFIG
RMISTISGLATLMGAQTVVVGMQPAVAITLVELGLTLPSVRTALDVERGMRLLQQPDAAP
Download sequence
Identical sequences A0A0A6TUT9 A0A0G8XJ83 A0A0Q0ETN5 A0A0W7XTM6 A0A1S1XL93 A0A1T1NXW9 A0A1T1R5P0 A0A1U8YWC2 A0A1V9GX22 A0A221MLZ4 A0A2D2UFS6 D4SYC4 D4T4U8 G2LWG2 H8FD53 Q3BW12 U4M6L0
gi|346724160|ref|YP_004850829.1| 316273.XCV1320 gi|78046876|ref|YP_363051.1| WP_003484273.1.100156 WP_003484273.1.100312 WP_003484273.1.100431 WP_003484273.1.101491 WP_003484273.1.101846 WP_003484273.1.101985 WP_003484273.1.102013 WP_003484273.1.10442 WP_003484273.1.11230 WP_003484273.1.12064 WP_003484273.1.12457 WP_003484273.1.1263 WP_003484273.1.12827 WP_003484273.1.13735 WP_003484273.1.14032 WP_003484273.1.14159 WP_003484273.1.14165 WP_003484273.1.15539 WP_003484273.1.15678 WP_003484273.1.16263 WP_003484273.1.16332 WP_003484273.1.17112 WP_003484273.1.17215 WP_003484273.1.19065 WP_003484273.1.19305 WP_003484273.1.19776 WP_003484273.1.199 WP_003484273.1.20043 WP_003484273.1.2014 WP_003484273.1.20169 WP_003484273.1.21227 WP_003484273.1.21303 WP_003484273.1.21317 WP_003484273.1.21440 WP_003484273.1.22114 WP_003484273.1.2230 WP_003484273.1.2259 WP_003484273.1.22888 WP_003484273.1.23342 WP_003484273.1.23534 WP_003484273.1.24172 WP_003484273.1.24624 WP_003484273.1.2476 WP_003484273.1.2491 WP_003484273.1.25231 WP_003484273.1.25999 WP_003484273.1.26095 WP_003484273.1.27112 WP_003484273.1.28321 WP_003484273.1.3003 WP_003484273.1.30571 WP_003484273.1.30677 WP_003484273.1.31364 WP_003484273.1.32205 WP_003484273.1.331 WP_003484273.1.34035 WP_003484273.1.34103 WP_003484273.1.3440 WP_003484273.1.35849 WP_003484273.1.3651 WP_003484273.1.3654 WP_003484273.1.3710 WP_003484273.1.37257 WP_003484273.1.37259 WP_003484273.1.37569 WP_003484273.1.37942 WP_003484273.1.38016 WP_003484273.1.39341 WP_003484273.1.39371 WP_003484273.1.40308 WP_003484273.1.40690 WP_003484273.1.41197 WP_003484273.1.42335 WP_003484273.1.42602 WP_003484273.1.43379 WP_003484273.1.43396 WP_003484273.1.43419 WP_003484273.1.43567 WP_003484273.1.4389 WP_003484273.1.44297 WP_003484273.1.44794 WP_003484273.1.45126 WP_003484273.1.45197 WP_003484273.1.46449 WP_003484273.1.46464 WP_003484273.1.46677 WP_003484273.1.47244 WP_003484273.1.47501 WP_003484273.1.47931 WP_003484273.1.47958 WP_003484273.1.48351 WP_003484273.1.49137 WP_003484273.1.49886 WP_003484273.1.50405 WP_003484273.1.51018 WP_003484273.1.51091 WP_003484273.1.52184 WP_003484273.1.52218 WP_003484273.1.5224 WP_003484273.1.52489 WP_003484273.1.52767 WP_003484273.1.5365 WP_003484273.1.53650 WP_003484273.1.54158 WP_003484273.1.54200 WP_003484273.1.54709 WP_003484273.1.55770 WP_003484273.1.55809 WP_003484273.1.55935 WP_003484273.1.56075 WP_003484273.1.56262 WP_003484273.1.56360 WP_003484273.1.57452 WP_003484273.1.57989 WP_003484273.1.58982 WP_003484273.1.59767 WP_003484273.1.6015 WP_003484273.1.60406 WP_003484273.1.60785 WP_003484273.1.61221 WP_003484273.1.61498 WP_003484273.1.61999 WP_003484273.1.62152 WP_003484273.1.64411 WP_003484273.1.64541 WP_003484273.1.65037 WP_003484273.1.65450 WP_003484273.1.656 WP_003484273.1.66420 WP_003484273.1.67180 WP_003484273.1.6771 WP_003484273.1.67877 WP_003484273.1.6838 WP_003484273.1.68383 WP_003484273.1.68402 WP_003484273.1.70738 WP_003484273.1.71353 WP_003484273.1.71699 WP_003484273.1.72092 WP_003484273.1.72305 WP_003484273.1.72777 WP_003484273.1.73738 WP_003484273.1.74035 WP_003484273.1.74121 WP_003484273.1.74178 WP_003484273.1.74279 WP_003484273.1.7523 WP_003484273.1.75313 WP_003484273.1.75734 WP_003484273.1.76535 WP_003484273.1.7704 WP_003484273.1.772 WP_003484273.1.77810 WP_003484273.1.78066 WP_003484273.1.78220 WP_003484273.1.78473 WP_003484273.1.79359 WP_003484273.1.79366 WP_003484273.1.79878 WP_003484273.1.79906 WP_003484273.1.80975 WP_003484273.1.81486 WP_003484273.1.81489 WP_003484273.1.81579 WP_003484273.1.81711 WP_003484273.1.82045 WP_003484273.1.83358 WP_003484273.1.83628 WP_003484273.1.85024 WP_003484273.1.85152 WP_003484273.1.86099 WP_003484273.1.86317 WP_003484273.1.8651 WP_003484273.1.87349 WP_003484273.1.88740 WP_003484273.1.89212 WP_003484273.1.89360 WP_003484273.1.89772 WP_003484273.1.90230 WP_003484273.1.91667 WP_003484273.1.9340 WP_003484273.1.93402 WP_003484273.1.93813 WP_003484273.1.94147 WP_003484273.1.94781 WP_003484273.1.94946 WP_003484273.1.95108 WP_003484273.1.96073 WP_003484273.1.96108 WP_003484273.1.96329 WP_003484273.1.96800 WP_003484273.1.97098 WP_003484273.1.97233 WP_003484273.1.97426 WP_003484273.1.98344 WP_003484273.1.98824 WP_003484273.1.9928 WP_003484273.1.99285 WP_003484273.1.99907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]