SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316273.XCV3197 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  316273.XCV3197
Domain Number - Region: 84-156
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.00876
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.015
Further Details:      
 
Domain Number - Region: 187-228
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0497
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316273.XCV3197
Sequence length 230
Comment (Xanthomonas campestris vesicatoria 85-10)
Sequence
MVSDAIAIAIAIGSVQAINYFVAQKYVEASTALATAPNRKFVLMPMESSGIIGSIAGVAE
LAKEAAGKPDAPVRVPPMPPRAGACAMRWDVAVWAMLALLLIAAETLVPGAFLLWMGIAA
AAVRVLVLVLPNIALLWQVVAFVLLSFVSVQVYRTWFRSKGRQSDRPLLNRPAEQLIGGC
VLLDQAIHDGRGRAKVDDAFWVVAGPDLPAGTPVRIVGADGMGLLVQPAG
Download sequence
Identical sequences Q3BQN5
316273.XCV3197 gi|78048753|ref|YP_364928.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]