SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_0732 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_0732
Domain Number 1 Region: 13-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000451
Family Anti-sigma factor antagonist SpoIIaa 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_0732
Sequence length 121
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MSDVQAVIRREEWDDVVLLHILTNSVDAVSAATIEHACTQMKPITVLDFADVAFINSAGI
SVLLKFVVAARKNGYKVFCLHVSPHHQKIFKMVEMTRFMPVIEEQDLAAYTNAQQSSISN
S
Download sequence
Identical sequences A9AWX9
gi|159897261|ref|YP_001543508.1| 316274.Haur_0732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]