SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_1477 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_1477
Domain Number 1 Region: 8-192
Classification Level Classification E-value
Superfamily ClpP/crotonase 9.4e-27
Family Clp protease, ClpP subunit 0.026
Further Details:      
 
Domain Number 2 Region: 364-432
Classification Level Classification E-value
Superfamily NfeD domain-like 2.48e-18
Family NfeD domain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_1477
Sequence length 436
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MRQLRILALIVWLSLVTLPSLSYAATDDAMCVASVSGIINPAVADYLQRSVIQAEQQACQ
GLVIKLNTPGGLTTSTWQIGETVLNAKLPVIVYVTPQGANAGSAGVFITYAAHIAAMSPN
TNIGAAHPVDGSGVDMEGDLRDKITNDAVARITTWAESNDRDAEWAEQAVRQSVSIGSNE
ALELGVINLIAQDDADLLRQLDGREVTLANGNQVTLQTQTSAFQPIEMTWLERLLHFLGD
PTIATMLISLGSLGIYFEAANPGLGVGGFLGVIAICLGLYGLSVLPLNTVGVVLLILAFV
LFGIDIFATAHGALTVGGLASFVIGALLLVDPAEAPGIIVSRALITGLGLGLASVIGLSI
WIIRRSKRVGRGASGDRLVGTIAKVRSSVAPEGTVFVEGALWQARSDDVLTVGDQAEIVG
LDGLTLIVRRVAHSGR
Download sequence
Identical sequences A9B3F8
316274.Haur_1477 gi|159898002|ref|YP_001544249.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]