SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_2296 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_2296
Domain Number 1 Region: 228-336
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.73e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_2296
Sequence length 342
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MADRQIALWNEEREQRKRALQRILITGSSFIFLLILYYVFGVDLSVGRNQLALGCLIGVL
VAAAISGWLVSIDQPEWATHAMFIPYMLIILVVATPVGVTSRGMYGLFIPIVAAALLLPA
RWSLIYAALAVVVFVSTDMLSPQPFSLNTTILNTLFAGGCFGTAAATTSFTARRLRQLLK
TSIEHSKELERNQAVLEERVQKRTLYLEKALDELQRSSETIRQMSVPVLPIAERVLVLPL
VGSIDLSRAALLSDELLNTIYQRRPHTILIDLTGLTTIDQVVAESLVQTLSAVRLLGTEP
IVVGLRSETVQALLDTGIDISHIRTFRDVQSGLGYATSKISY
Download sequence
Identical sequences A9AXX0
gi|159898817|ref|YP_001545064.1| 316274.Haur_2296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]