SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_2740 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_2740
Domain Number 1 Region: 18-184
Classification Level Classification E-value
Superfamily GAF domain-like 8.94e-21
Family GAF domain 0.01
Further Details:      
 
Domain Number 2 Region: 196-302
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000192
Family Anti-sigma factor antagonist SpoIIaa 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_2740
Sequence length 307
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MTAYESSRHHQPVEQTILAIHELIRAILLPRDLADVCRTIFEQLHHVLRFDAGFIEQYQP
KTDTMQTIYSIDEGIENVVPYAWDYRRSKVVTWIIANQQLVRFDDLHEDLPKRFTVENTR
SFGQEEKRSRAWMSVPLLIGTDFVGVLNIQSYQPALYGEFEEALLSTVASSVALALDNAQ
VLAELELEVSELDIPRIPLSDDVLIVPLIGVLDRLRWENLTHTILETLRERGCEHVLLDG
SGLLTFDPDAIQAISTIVKAIELIGAKSMLIGLRPSLIEGLIRAGIHLTNIRTARDLPMG
LAMLGIR
Download sequence
Identical sequences A9B1T6
316274.Haur_2740 gi|159899259|ref|YP_001545506.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]