SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_2741 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_2741
Domain Number 1 Region: 10-180
Classification Level Classification E-value
Superfamily GAF domain-like 1.33e-19
Family GAF domain 0.0053
Further Details:      
 
Domain Number 2 Region: 190-276
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000053
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_2741
Sequence length 302
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MPTTEALVRARAELECIQEFGRIIHSTRDRFVVYESFYQLLEQVVPIDHGTISFFDAQQN
LRHVYVIAHRRGNFADEPVTIKPHTPSAWILRQRKPLLFENIYTDSHSEINLEHALGADL
HHASCSWLGLPIMLGSQLLGLVTIQHHETAAYGDRELQLLQTLSLMLATTINQIQRVEEL
EVLRLALSAPTIPVDQHLWIVPVIGRVDQQRLAILQTILLGHVERQRIRYVVLDLTGMRS
FDPQATGLFNKLIGALRLLGATCIVSGVQAENSAVLSPILSQHNVLIVRDVQQSLRYLKR
QI
Download sequence
Identical sequences A9B1T7
316274.Haur_2741 gi|159899260|ref|YP_001545507.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]