SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_2931 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_2931
Domain Number 1 Region: 228-332
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000589
Family Anti-sigma factor antagonist SpoIIaa 0.0098
Further Details:      
 
Domain Number 2 Region: 129-177
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000000994
Family HAMP domain 0.0041
Further Details:      
 
Weak hits

Sequence:  316274.Haur_2931
Domain Number - Region: 168-223
Classification Level Classification E-value
Superfamily t-snare proteins 0.0596
Family t-snare proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_2931
Sequence length 338
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MIAAPQIALQTFLNIPSSQTLSPSQTLELQMNPTTAPALASVLERMQNNQSGIQTLQANN
QELVVANAALTSINWHIVVVAPKTEITSEAQAVTATIETSSGRIVGKLLWFLAALTIITL
LATWLISNRLSQPIVALVQNTQALAESNQFVQLPEQSNDELGFLARAFNQMASKVQSAQQ
SLQQVNQNLEQTVQQRTHELEQERESLQQTLDQLQQANSTVAKLTAPIIPVAQGVVVVPI
TGSLNTERIEQLQQAMLRTAERLRIHTVILDVTGLEVLEDSATFVRSLDALRLLGSKAML
VGVSADFAQDLIQSGINLDSVTTMANLQAAVRATLNQA
Download sequence
Identical sequences A9B3J7
316274.Haur_2931 gi|159899450|ref|YP_001545697.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]