SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_2953 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_2953
Domain Number 1 Region: 424-532
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.35e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0074
Further Details:      
 
Domain Number 2 Region: 15-140
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.01e-16
Family Flavin-binding PAS domain 0.092
Further Details:      
 
Domain Number 3 Region: 270-394
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000262
Family Heme-binding PAS domain 0.042
Further Details:      
 
Domain Number 4 Region: 160-276
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000907
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_2953
Sequence length 549
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MGTDVYVERDETTIDQQQTIINLRAQIAIYEQILDSIPDLILYKGPGSHIRYANRAFREY
YGMDSQQLQDLIDADFNQPSYTEQYIRDDAQVFQTGQALVIDSEPVTRHTGEVHLFATTK
HPIRNHDGSIIGTVGISRDLSNEVAASAALTDNEARLQRIIENVPGMVYQFLLEPDHTMR
FPFVSTGSRDIYGLEPEAIMQNASIVTEAVNPADRLRFQEAIMTSAQTLEPWRWEGRVYI
NGQENWLQGASRPTKLANGAILWDGLLLNITQQKQAEALLGRFDTILSSTPDLVAIADLS
GQMQYLNPAARRLLQLEPTDQVSQLTWHDLHPNQAEQTWLAKTLQHAQIHGSWMGEHQLQ
TAQGQKLPVMYQMLCHYDIDHQPSFFSMIAHDISDQKQAEAERQRLHEEVIRTQQQALIE
LSTPLIPIADTVVLLPLVGSVDTARAQQFMETLLEGVHINKAQIAIVDVTGVPVMDTQVA
GLLIRAATSVQLLGARVIITGIRPELAQTLVTLGVDFRSIMTHSSLQQGITYAINATRGQ
QMNVRYRGN
Download sequence
Identical sequences A9B3L9
gi|159899472|ref|YP_001545719.1| 316274.Haur_2953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]