SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_3162 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_3162
Domain Number 1 Region: 526-631
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000133
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 
Domain Number 2 Region: 391-493
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000096
Family Heme-binding PAS domain 0.078
Further Details:      
 
Weak hits

Sequence:  316274.Haur_3162
Domain Number - Region: 350-393
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0301
Family HAMP domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_3162
Sequence length 638
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MRAFFTPATWLMKRLTYPQKFGLLSLVFAIPLTFLLSAQLTEIQRQINFTRSELTGTTYL
QPLREILQDIIEQQLIAEQYLGGDQAFLTPLLLKNEELAQHLETFKAFDLQYQDRYDTQT
QVTILFNEWERLQAQLTLRSVPDSNAAHDRLIQAVRACMQRIGDQSGLILDPNIDSYYLM
NALIETLPAHQAATARVAGAGGNAITRGTVSSEEKNTLTVVNSQLQETNTKINYSLGVVF
SNNESLRPLLESAVRTFIQATEELSFQIILQVIRVETPTIDPSIFRQETERTLNASFSLW
DQTSIQLDNVLNQRIGQAQNRRIFFISLITILVLVAVYLFLGFYRAVMDTVRAFQQAAGS
MLSSNTLSNVAIDTRDELGQVATSFNSIASAMVESSSQRQAIVDHAAEAIITYDQQGIIR
SANRAAERILGRNVDQLNIAEVLGVELANIQQQTTTYEFDVRLPTNEIQPVEMVLGTMQL
GEQQLWIAFLRDIRIRRRTEQERNRLQDEIIRGHAAVLARLSAPLIPLSDNVVVMPLVGA
LDGERLQQITNNLLEGLSNQRARVALLDMTGVPNVDREVASRLLRAAQGIRLLGADLILT
GIQPDVAQALISVGGDLSDLQTYPTLQQGIRMVLRNLA
Download sequence
Identical sequences A9B606
gi|159899680|ref|YP_001545927.1| 316274.Haur_3162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]