SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_3688 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_3688
Domain Number 1 Region: 234-331
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000294
Family Anti-sigma factor antagonist SpoIIaa 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_3688
Sequence length 350
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MALATPTPQQSLVERIRLLVIAQTVMVGLIGIATWFLVEIPKERAGVALGLALVTTINVF
LYLLRKSRHAPRIVVVNFLLIVGVIVLTDATGAQLSGMNWTLYLIWPALTMLVLRELRYV
LVVSVVTLAALITFPLLEIYGVISLELMIPAPMLLLKLIIFVVVFLILTSMMIVIGLADQ
RSQKVLAEHTALITNQQAELAQANQSLQAGNHQLQALAQRQESLLNQIQLLEAPIIRLGN
NAILLPITGMLDQQRISHIRSAVLQQIYQLRAQHLILDMTGALLPDASVLPDFADMLAAI
KLLGCEVRVTGMTSEIVQQLVFTDVDLRIFGKTGQLEQLIQEVLQPSKGK
Download sequence
Identical sequences A9B6B3
gi|159900205|ref|YP_001546452.1| 316274.Haur_3688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]