SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_4094 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_4094
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.85e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_4094
Sequence length 113
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MAELIQETNGKVLIVRLPARMDAAAVRELEEPFAQSIADHNGPVLVDVSKVDFAASLALR
MLMMNLKDQQNRGQNLMLFGLQTQIAEVFRKTRFDTLFTIADDEASGIEQLSA
Download sequence
Identical sequences A9AWG7
gi|159900607|ref|YP_001546854.1| 316274.Haur_4094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]