SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316274.Haur_5198 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316274.Haur_5198
Domain Number 1 Region: 190-301
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.9e-20
Family Heme-binding PAS domain 0.059
Further Details:      
 
Domain Number 2 Region: 296-427
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.43e-17
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.025
Further Details:      
 
Domain Number 3 Region: 28-169
Classification Level Classification E-value
Superfamily GAF domain-like 1.81e-17
Family GAF domain 0.018
Further Details:      
 
Domain Number 4 Region: 580-690
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000001
Family Anti-sigma factor antagonist SpoIIaa 0.0099
Further Details:      
 
Domain Number 5 Region: 429-551
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000925
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 316274.Haur_5198
Sequence length 694
Comment (Herpetosiphon aurantiacus ATCC 23779)
Sequence
MEVAPIPSDESARIQALHGLGILDTPPDPRFDRLTRLAQRLFHVPIVLISLVDTNRQWFK
SCIGLDVQQSSREISFCAHAILQPDRPLIILDTWCDTRFADNPVVSGTPHIRFYAGHVLH
APSGAAVGTLCLLDTVVHSVFSDDDQEILADLAMLVERELAANTMHELLQTQHRLMTDFQ
ESELRFRQMAETIDAVFWMSDSTRQQLLYISPAYERIWGYSCASLYADLQSWVTTIHPDD
RASVTASMSKQAHTLRALEYRIIRSDGAERWIYDQSYPIYNDSDQVIRLVGLARDITQRK
QQDLRVVQLTEQLTSLMQSLPGVVYRCSPDINWGVTILSDGIETLTGYPASDFLHNTIRP
FVSCIDPLDRVRVEETMTAAIIAQQPYSVDYRIIHRDGEVCWVTNRGRAVYDDAGRVRWC
DGVIIDVNARAAIEADHRRFVQLADMLPEFVGMATLDGQPIYINPAGRALIGMRPEEPLA
RQPLTALHPSWVQELLQTTALPTALAEGYWSGETALVTADGNEIPIDQMILCHRDAADQP
THFSTIARDLTHERQAAATRQALQAEILQIHTRTIMELSTPLIHITDTTILMPLIGAIDT
IRAQRILESLLQGVSQQRASRAIVDLTGVPALDPHVAAIFIQAADAVRLLGAEVIVTGIR
PEIAQTIVTMGVDLRRIRTYSDLHQGISYAMQGL
Download sequence
Identical sequences A9B911
316274.Haur_5198 gi|159901707|ref|YP_001547953.1| gi|159901707|ref|YP_001547953.1|NC_009973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]