SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316278.SynRCC307_2254 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316278.SynRCC307_2254
Domain Number 1 Region: 137-304
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.25e-29
Family D-glucarate dehydratase-like 0.0017
Further Details:      
 
Domain Number 2 Region: 1-96
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.34e-16
Family Enolase N-terminal domain-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 316278.SynRCC307_2254
Sequence length 318
Comment (Synechococcus RCC307)
Sequence
MQLRWRPYRWALQPPLITACGPWSERRGWLLRLEDPGSGSAGWGEAAPLPAEHAQCADAL
AALPSECSTEHLEQALRALPGPAAFAIGLALAELEGLQGGQWLPAPASAVLLPAGGEAIA
ALKSALQRATGEPAEFAAKWKVGVLDPDTELQLLEQLLEQLPSGAQLRLDSNGSWDRATA
GRWAMRLKHEGKLQWLEQPLPPSDHAGLLALGRRLPVALDESLRHPSGLPPGWSGWLVHK
PALEGDPRPLLLQLKQGAAKQMVSSALESGIGARAVAHMAALASRGPTPCAAGLAPGWGA
SGDLASTIPQQVWEAAGS
Download sequence
Identical sequences A5GW98
WP_011936666.1.22971 NYSGXRC-9764a gi|148243353|ref|YP_001228510.1| 316278.SynRCC307_2254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]