SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 316279.Syncc9902_0845 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  316279.Syncc9902_0845
Domain Number 1 Region: 438-516
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000169
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 316279.Syncc9902_0845
Sequence length 523
Comment (Synechococcus CC9902)
Sequence
MANRSSSTLVNQWFSNPSKDLLSGLVVAFAMIPEAIAFSGIAGVDPKVGLFGAFCLSLTI
AVVGGRMAMITSATGSTALLMTGLVASGEGIGPGLGVKYLLVAGLVTGVLQILWGYMRLA
DQMRFVPQGVLSGFVNALALLIFQAQLPQLGFGGGHGEGGDHAAGLLLPHGGQVPVVWAL
VMLGLVIIYGLPRLTRAVPSQLVAIVVLTAISIGFHFDIPTVSSLGNLPDGLPSFGIPFG
QGSGGVPFNLETLGLVLPTALAISLVGLMESFLTQDILDDKTDSPSNKNVEARGQGIANI
VSSLFGGMAGCALVGQSVMNIDNGGRTRLSTLFSGVSLLAMILLAGSWLKQIPMAALVAV
MISIAVSTADINGLRNVRRIPKSDTSVMLMTFAVTMLTTPHNLALGVLAGVALAGILFSR
KVAKVIRVESDQISAQERHYRVIGQLFFVSTIYFVQGFDLHDHPERISIDLSQAHIWDQS
GVAALDQVIRKLRLGGSEVTVVGLNQESLDLFERIGGQESSHA
Download sequence
Identical sequences Q3AYL6
WP_011359649.1.34419 gi|78184420|ref|YP_376855.1| 316279.Syncc9902_0845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]