SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 317025.Tcr_0946 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  317025.Tcr_0946
Domain Number 1 Region: 20-217
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.33e-25
Family Clp protease, ClpP subunit 0.037
Further Details:      
 
Domain Number 2 Region: 390-454
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000183
Family NfeD domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 317025.Tcr_0946
Sequence length 463
Comment (Thiomicrospira crunogena XCL-2)
Sequence
MNHVVKLNTWMAWLIWLGVFLQSAPAFSAETTKTLHNQVVQLTVQDAIGPATVDYIERSL
EKTAQQRAELVVIQLDTPGGLSSAMRSIIQAIARSPVPVATFVAPSGARAASAGTYILYA
SHIAAMAPGTNLGAATPVQMGGISLPNPSENSQKTPNEPASEEASKRKVINDAVAYIQGL
AQLHNRNADWAEKAVREAASLPANEALKLNVIDVIADNLRDLLQQVDGKQVTLNGQTINL
KTADANIVQLAPDWRSELLSVITNPNIAYILLLIGVYGLIFEFLNPGGIVPGTIGAIALV
LALYAFQLLPINYAGMALILLGVGLMIGEAFEPSFGILGIGGTVAFVFGSIILMDTDAPG
FGIDLSVIITFAVISALILIAVVHLALKSYRQPIVSGVQELVGAEARVVEDFDRQGHVII
HGEHWQAISQTPLKQNQMVKVTGLKNLTLTVEPVESTTEERSV
Download sequence
Identical sequences Q31H32
gi|78485290|ref|YP_391215.1| WP_011370368.1.20162 317025.Tcr_0946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]