SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 317025.Tcr_1709 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  317025.Tcr_1709
Domain Number 1 Region: 204-457
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.85e-55
Family Pyruvate oxidase and decarboxylase Pyr module 0.04
Further Details:      
 
Domain Number 2 Region: 14-223
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.96e-20
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 
Domain Number 3 Region: 472-578
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 9.42e-16
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 317025.Tcr_1709
Sequence length 581
Comment (Thiomicrospira crunogena XCL-2)
Sequence
MTHPVSAPQNSLAISVSGSGGTGAVTVGLILLEAVAKAGFYGVMTRSFGPQIRGGESAVM
LNLSDQPIETLAEFSHIHLALDWLKFERFADEIPLTQDSLVIYDNCREKPPGLVESSGAQ
LIGVALQNAVKTIQGSRMNMFALGVLAHQIGLDSTFIEAALKKTLGKKGDAVITPSLEAV
QAGRQLIPNSHYDVLSGWQPSNHPRWNISGNEACGLGTLRGGLKLAAAYPITPATDIVEY
LAPRIEKLGGRVLIAEDELAAMNMVIGGSFGGYPSMTATSGPGFSLMTEAMGLAIASETP
ALVVTVMRGGPSTGIPTKSEQTDLNQVLYGFHGEAPHVVIAPLNVQEMVTISQWSLGLAE
ALQTLVVEVSDQHLGQSRVIIDPVPPVDFNLKRLIPPTTQSDYQRYQLTQDAISPMAWLG
TPNAQYTADGLEHTETGKPSSAAKDHQQQLAKRAQKTTQYDYGERWAKLTEKEAANVMVI
TWGSSYEAVRVAVETLNKQGAHISLLGLRLLMPLQTKKIQALCKGKTVIVIEQNTSGQLF
HYLLSDNAIPRKSQSIAEAGPILFKPSTVQAALTDCLEAIK
Download sequence
Identical sequences Q31EX2
317025.Tcr_1709 gi|78486050|ref|YP_391975.1| WP_011371130.1.20162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]