SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 317655.Sala_0148 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  317655.Sala_0148
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily GlnB-like 2.89e-46
Family Prokaryotic signal transducing protein 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 317655.Sala_0148
Sequence length 112
Comment (Sphingopyxis alaskensis RB2256)
Sequence
MKKIEAIIKPFKLDEVKEALHEVGVSGITVTEAKGFGRQKGHTELYRGAEYVVDFLPKVK
LEVIVEDGMAERVVEAIAAAAQTGRIGDGKIFVIPVETALRIRTGERNEDAL
Download sequence
Identical sequences A0A0W1CI59 Q1GWV0
317655.Sala_0148 gi|103485644|ref|YP_615205.1| WP_011540464.1.101919 WP_011540464.1.11395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]