SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 317655.Sala_2216 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  317655.Sala_2216
Domain Number - Region: 88-146
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00144
Family NfeD domain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 317655.Sala_2216
Sequence length 148
Comment (Sphingopyxis alaskensis RB2256)
Sequence
MPDWLTNMEPHWAWLSLGVLLAAAEIVAPGFFLIWIGAAAIVTGVIAWVVPLSVPFQLGI
FALLSFVALYGGRRWLRMNPITTTDPHLNQRGGRLVGEVLTVTKAIEDGRGRVRVGDGEW
PVRGPDAAEGAKVRVVSADGGVLVVELA
Download sequence
Identical sequences Q1GQZ7
WP_011542501.1.11395 gi|103487697|ref|YP_617258.1| 317655.Sala_2216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]