SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 318161.Sden_2190 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318161.Sden_2190
Domain Number 1 Region: 33-212
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.18e-20
Family Clp protease, ClpP subunit 0.052
Further Details:      
 
Domain Number 2 Region: 387-450
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000222
Family NfeD domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 318161.Sden_2190
Sequence length 468
Comment (Shewanella denitrificans OS217)
Sequence
MFTLMLRSLLLCGLLGLALCTHGQEKVADISIAKTIPVLRFEGAIGPAVSEYLVTEITAA
NSLNINIRPPLLVIVFDTPGGLVSSLRDINQRILTSNIPIACLVAPVGARAMSAGTYILY
ACHIAAMAPATTLGAATPVQMGPASPSPAKSEDEQNGSKDKSAMEKKVLNDSIAYIRALA
QLRGRNQAWAELAVKEAATLTAEEALAQQVITLMAEDVAQLIGSLHGWTLNLAGTQHQLD
LNQAQVIERPMDWRNQFIATITNPNIAYILMLIGIYGLLLEFYSPGIGIAGVIGGISLLV
ALYAFQLLPINYAGLGLLILGIVLLVAESMVPSVGIFGLGGAAAFALGSIFLLDTDSDLS
ISLPLIAAVTVTAILFTLWVLSSIWKSRNQPAVSGDEAILGAEAKVITGFEHQGFVLLGG
ETWAAISDTQTTTDQRVKVIARNKLTLTVTGLSNDKIMDEPVADKRTT
Download sequence
Identical sequences Q12M55
WP_011496624.1.19895 gi|91793543|ref|YP_563194.1| 318161.Sden_2190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]