SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 318161.Sden_2375 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318161.Sden_2375
Domain Number 1 Region: 25-239
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2e-51
Family Voltage-gated potassium channels 0.0001
Further Details:      
 
Weak hits

Sequence:  318161.Sden_2375
Domain Number - Region: 244-271
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0105
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 318161.Sden_2375
Sequence length 276
Comment (Shewanella denitrificans OS217)
Sequence
MKPELASTADTRQHLRAIIFGTETRWGRYFDISLIVCILLSVSLIFIDTIDSVHQEYGGL
IRIGEWFFTVLFTLEYSLRLYCSENRFSYAKSFYGLVDFISILPSYLGLFIPGANAALAI
RVLRLFRIFRVLKLLRYLAEGNLLLKAMMQSSRKVFLFFFSVSLIIMVLSVVMYVIEGPH
NGFTSIPKSMYWTVVTITTVGYGDITPQTPLGQGIAALTMLIGYSIIAIPTGILTAEISH
EMVKMRDLRKCSNCGKTGHDNEAKFCTQCGSELETL
Download sequence
Identical sequences Q12LM1
WP_011496806.1.19895 gi|91793727|ref|YP_563378.1| 318161.Sden_2375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]