SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 318167.Sfri_0280 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318167.Sfri_0280
Domain Number 1 Region: 154-331
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.1e-40
Family D-glucarate dehydratase-like 0.00019
Further Details:      
 
Domain Number 2 Region: 9-123
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 0.00000000000000636
Family Enolase N-terminal domain-like 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 318167.Sfri_0280
Sequence length 364
Comment (Shewanella frigidimarina NCIMB 400)
Sequence
MSSDNSTITSCTLYQYQIELNPSLPVGIQRIDIRKGLVLATQLNNQQVAWVEIAPLSGID
IDSQPITGFSQESLDEVTSQLLQVLPNFIDQPLVILTNIAEQISLPSLAFSLSLLHAKLT
DKLPVRIENPQTQLAVVPLLYDGMSAHVITQKLQTLTSINSVKIKVAQTSMESDIQFIYQ
VLAIAPHVTLRLDANRGFSLEQAIDFLACLPKHKIEYIEEPCINPSDNAQIYRQLGIKYA
LDESLNSSQFDLDLALQQPGLGALIIKPMLLGSLEKLQNMISQAHLAGVRCILSSSLESD
LGISDLRIVSQALTPDEPPGLDTLSAFSKPVLLATSGFSPRLNHQVLKLLTHIGQPQDSD
EAGI
Download sequence
Identical sequences Q089C2
WP_011635770.1.15765 gi|114561468|ref|YP_748981.1| 318167.Sfri_0280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]