SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 318167.Sfri_1110 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  318167.Sfri_1110
Domain Number - Region: 30-71
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0471
Family NfeD domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 318167.Sfri_1110
Sequence length 100
Comment (Shewanella frigidimarina NCIMB 400)
Sequence
MKAKLIAFAAAATLAMGVSSVWAQGALHQGEVLDTMNGGGYTYVQLKEADKTYWAAGPQT
EVTKGDKVEVSEQMWMSDFKSSSLNRTFDKIMFVGNINKK
Download sequence
Identical sequences A0A2I0H5R3 Q085V2
WP_011636584.1.15765 gi|114562288|ref|YP_749801.1| 318167.Sfri_1110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]