SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 318167.Sfri_1590 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318167.Sfri_1590
Domain Number 1 Region: 28-239
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.55e-54
Family Voltage-gated potassium channels 0.0001
Further Details:      
 
Weak hits

Sequence:  318167.Sfri_1590
Domain Number - Region: 242-271
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0324
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 318167.Sfri_1590
Sequence length 276
Comment (Shewanella frigidimarina NCIMB 400)
Sequence
MNIEEKADSPLKQQLRSVIFGTETPAGKRFDITLMVCIVLSVILIFIDTIEHINSRYGDY
ISIAEWTFTVFFTVEYILRLYCSLNRLHYARSFFGVVDLVSILPSYLGLIFPGANVALAL
RVLRLFRVFRVLKLLRYLSDGNLLIKAMMQSSRKVFIFFFSVSLIIMVLSVVMYVVEGPN
NGFTSIPKSMYWTVVTITTVGYGDITPQTPLGQGIAALTMLIGYSIIAIPTGILTAEISH
EMVRTRDLRKCSNCGKKGHDNDAEYCNHCGSELEKL
Download sequence
Identical sequences A0A2I0H803 Q083X4
WP_011637059.1.15765 gi|114562766|ref|YP_750279.1| 318167.Sfri_1590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]