SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 318167.Sfri_3591 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318167.Sfri_3591
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.31e-21
Family Sfri0576-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 318167.Sfri_3591
Sequence length 121
Comment (Shewanella frigidimarina NCIMB 400)
Sequence
MLCQIPDITKGVISLFVSGRLSAQDYRTRLQPAIKSYRKDWNQVCLYIEADVLLEGWEFG
SLTGSGEVQLPAFDALVFVGGPDWVGNSVRLMGPFMQGEVAWFPLERKQEAITWIAKRSL
C
Download sequence
Identical sequences A0A119CZT3 A0A2I0HAK8 Q07X46
WP_011639008.1.15765 WP_011639008.1.45693 318167.Sfri_3591 gi|114564743|ref|YP_752257.1| 372250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]