SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 318167.Sfri_3705 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318167.Sfri_3705
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.42e-25
Family Anti-sigma factor antagonist SpoIIaa 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 318167.Sfri_3705
Sequence length 109
Comment (Shewanella frigidimarina NCIMB 400)
Sequence
MNIEIETHNNYQVVKLYGEVDLSNSRSIKLDIIKLIKSKNNIIVDFTHLQYIDSSGMASL
VEAFNEARENDTEFHIVGANGSPLQVLQLTRLNTVFNLADSVSAVSNNG
Download sequence
Identical sequences A0A106BWS7 A0A2I0H975 Q07WT2
318167.Sfri_3705 WP_011639120.1.15765 WP_011639120.1.45693 gi|114564857|ref|YP_752371.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]