SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 318586.Pden_0244 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318586.Pden_0244
Domain Number 1 Region: 105-364
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.01e-60
Family D-glucarate dehydratase-like 0.00037
Further Details:      
 
Domain Number 2 Region: 1-121
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.57e-28
Family Enolase N-terminal domain-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 318586.Pden_0244
Sequence length 383
Comment (Paracoccus denitrificans PD1222)
Sequence
MKIAKVEALSVAMGDGTGWMPTSAFVRITAEDGTVGWGEASPMLGGIASLGVVARDIAPF
LEGQEVLDHAVLLDRMMHRLVKLGPEGIATAALAACDIALWDLKGKLLGQPIYKLLGGAW
RTRLPCYSSIGGNAARSVDEVVREVARRVEAEQPAAVKIRWDGDRTRCDVDIPGDIAKAR
AVRELLGPDAVIGFDANNGYSVGGAIRVGRALEDLGYSWFEEPVQHYHVGAMGEVAQRLD
ITVSAGEQTYTLQALKDLILSGVRMVQPDIVKMGGITGMMQCAALAHAHGVEFVPHQTQP
GVGHFANIHVLSTLMHMTKPVELADRWDRGRPVFRNPAEPVDGHFALGDAPGLGIVVDED
ELASRATEITVGRDQRPPAGGQY
Download sequence
Identical sequences A1AYL4
gi|119382998|ref|YP_914054.1| NYSGXRC-9840a WP_011746591.1.25907 WP_011746591.1.3707 WP_011746591.1.52749 318586.Pden_0244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]