SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 318586.Pden_2108 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318586.Pden_2108
Domain Number 1 Region: 154-229
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000149
Family CAP C-terminal domain-like 0.051
Further Details:      
 
Domain Number 2 Region: 18-143
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000415
Family cAMP-binding domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 318586.Pden_2108
Sequence length 243
Comment (Paracoccus denitrificans PD1222)
Sequence
MAITEYFVRYLQRRDLLSEADIACLRAIPTVHVCFRPGEVIVPRGRLATRSCMMLRGMAA
RRHDLVGRPGERVITALHVPGDFVDLHGFVLAGLEHDVISVGESEVEFVEHADLRRITQD
FPHLTRLLWMSTVIDAAIHRQWLVATASLRSSAHLAHLLCELYTRLSSVGAAQDHRFTLP
LLQKELADILGYTPIHVNRAVRDLRADGLIRWTGSEVEILDWQRLVRLARFDPEYLDLGR
VRR
Download sequence
Identical sequences A1B3V6
318586.Pden_2108 gi|119384840|ref|YP_915896.1| WP_011748395.1.25907 WP_011748395.1.3707 WP_011748395.1.52749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]