SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 318586.Pden_4060 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  318586.Pden_4060
Domain Number 1 Region: 139-422
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.56e-124
Family Enolase 0.0000000251
Further Details:      
 
Domain Number 2 Region: 3-136
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.08e-57
Family Enolase N-terminal domain-like 0.0000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 318586.Pden_4060
Sequence length 425
Comment (Paracoccus denitrificans PD1222)
Sequence
MTAIIDIFAREILDSRGNPTVEVDVTLEDGTMGRAAVPSGASTGAHEAVEKRDGDKARYL
GKGVLEAVAAVNGEIAENLIGEDATEQVAIDRMMIELDGTPNKGRLGANAILGVSLAVAK
AAAEACSQPLYRYVGGAGARVLPVPMMNIINGGEHADNPIDIQEFMIMPVAAENIREAVR
MGSEVFHTLKKELSSAGLATGVGDEGGFAPNLSSTRDALDFILKAIEKAGYQPGDDIMLA
LDCASTEYFKGGKYEMAGEGKSLSPAENVAYLEALCNDYPILSIEDGCAEDDWDGWKLLT
DTLGGRVQLVGDDLFVTNPARLAEGIAKGCGNSLLVKVNQIGTLTETLDAVRMADRARYT
SVMSHRSGETEDATIADLAVATNCGQIKTGSLARSDRLAKYNQLIRIEEMLGATAEYAGK
SILRG
Download sequence
Identical sequences A1B9D2
318586.Pden_4060 gi|119386767|ref|YP_917822.1| WP_011750294.1.37760 WP_011750294.1.52749 WP_011750294.1.86657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]