SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 319224.Sputcn32_0545 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  319224.Sputcn32_0545
Domain Number - Region: 91-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00129
Family NfeD domain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 319224.Sputcn32_0545
Sequence length 156
Comment (Shewanella putrefaciens CN-32)
Sequence
MELSNPILMWSVIGIILMLAELIVPGGIVILLGAACLVVAGALGIGLVEGIVQSMTLWFI
SAIVLLLSFRQLTQRLVGGDSHVDNTDEELDIYNQIARVKQTIGPGQTTGRVEFQGSEWP
ALGDGSIIAVGCEVRIICRENIALVVEPVTQATSQN
Download sequence
Identical sequences A4Y2U4 E6XH62
gi|386312257|ref|YP_006008422.1| gi|146291652|ref|YP_001182076.1| 319224.Sputcn32_0545 351745.Sputw3181_3627 WP_011790867.1.65999 WP_011790867.1.82224 WP_011790867.1.85280 WP_011790867.1.98421 gi|120600416|ref|YP_964990.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]