SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 319224.Sputcn32_1042 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319224.Sputcn32_1042
Domain Number 1 Region: 463-570
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.75e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 319224.Sputcn32_1042
Sequence length 585
Comment (Shewanella putrefaciens CN-32)
Sequence
MSHSAHLFSLRIAHALTEACVKDKYSLKRFGQDLLAGLTVGIIAIPLAMALAIASGVAPQ
YGLYTAIIGGFIIAMSGGSRYSVSGPTAAFVVLLYPIAQQFGLAGLLVATVMSGMILVAM
AMLRLGRLILYIPESVTLGFTAGIGVVIATLQLKDFFGLPIEHMPEQYFSKLITLGQALP
TMHLPSFLVATITLATMLLWPKLKIPVPAHLPAIALGSIIALALNAMGADIETIGTRFHY
QLTDGTTGMGIPPVLPSFEWPWLQAGANGQPFEFNLTTFQALLPAAFAIAMLGAIESLLC
AVVLDGMTGKRHSANSELLGQGIGNIITPFFGGIPATAAIARSAANVKAGAQSPIASMIH
AIVVLIGLVALAGVLAYLPMSAMAALLLVVAWNMSEAPKAMHLIKTAPTSDILVFISCFS
LTVIFDMVIAISVGIILAALLFMKEIAEMTRLYDISSNKRYVDQPLPADWTVLKINGPLF
FAAADRIFAEIASLAQDKRVIVLYLDGVSILDAGGLAALTKLIEKCKKSNTKLIVADLQF
QPIRTLAKAKVQPIEGVLKFYPTLREALAEAPLVSEQTEPVADNL
Download sequence
Identical sequences A4Y487
gi|146292145|ref|YP_001182569.1| 319224.Sputcn32_1042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]