SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 319224.Sputcn32_2667 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  319224.Sputcn32_2667
Domain Number - Region: 29-72
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0549
Family NfeD domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 319224.Sputcn32_2667
Sequence length 100
Comment (Shewanella putrefaciens CN-32)
Sequence
MMAKLVKLAAVATLALGMSSAWAQGVTHEGTVVDTMNGGGYTYVQIKEADQTFWAAGPQT
EVNKGDKVAVVEQMWMNEFTSKTLNRTFDKLLFVGQIEKK
Download sequence
Identical sequences A4Y8V3 E6XHI8
gi|120598167|ref|YP_962741.1| WP_011788693.1.65999 WP_011788693.1.82224 WP_011788693.1.85280 WP_011788693.1.98421 gi|386314508|ref|YP_006010673.1| gi|146293761|ref|YP_001184185.1| 2005244412 319224.Sputcn32_2667 351745.Sputw3181_1344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]