SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 319225.Plut_0415 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  319225.Plut_0415
Domain Number 1 Region: 13-136
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 0.0000051
Family HEPN domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 319225.Plut_0415
Sequence length 148
Comment (Chlorobium luteolum DSM 273)
Sequence
MGLHEDVGYRLNLAGGFLKEAEQDFGLSRWRSCTAGSVLVVENAGIAVLMLFGVSPSTHK
PGMHLSQLLSEGTLERKAAELIEELLPMFEQHDSHEKMLAKYGDEAGCRLPWEIFGEPEA
SAALDAARKAVRIASDLAAIVLPKDMKK
Download sequence
Identical sequences Q3B5S8
WP_011357178.1.73161 gi|78186303|ref|YP_374346.1| 319225.Plut_0415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]